Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308634
StrainMtb_RGTB327
Protein IDYP_005361445.1
Description uridylate kinase [Mycobacterium tuberculosis RGTB327]
Sequence MTEPDVAGAPASKPEPASTGAASAAQLSGYSRVLLKLGGEMFGGGQVGLD
PDVVAQVARQIADVVRGGVQIAVVIGGGNFFRGAQLQQLGMERTRSDYMG
MLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGR
VVIFGAGMGLPYFSTDTTAAQRALEIGADVVLMAKAVDGVFAEDPRVNPE
AELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNLLTDGNIARAV
RGEKIGTLVTT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo