Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308796
StrainMtb_RGTB327
Protein IDYP_005361607.1
Description ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium t
Sequence MLNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENY
YEREVLDQYSRNFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo