Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308848
StrainMtb_RGTB327
Protein IDYP_005361659.1
Description NADPH:adrenodoxin oxidoreductase fprA [Mycobacterium tuberculosis R
Sequence MRPYYIAIVGSGPSAFFAAASLLKAADTTEDLDMAVDMLEMLPTPWGLVR
SGVAPDHPKIKSISKQFEKTAEDPRFRFFGNVVVGEHVQPGELSERYDAV
IYAVGAQSDRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQVSPDLSGARA
VVIGNGNVALDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRR
GPLQAAFTTLELRELADLDGVDVVIDPAELDGITDEDAAAVGKVCKQNIK
VLRGYADREPRPGHRRMVFRFLTSPIEIKGKRKVERIVLGRNELVSDGSG
RVAAKDTGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRING
SPNEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKSFPE
DHADQVADWLAARQPKLVTSAHWQVIDAFERAAGEPHGRPRVKLASLAEL
LRIGLG
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetNo