Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308938
StrainMtb_RGTB327
Protein IDYP_005361749.1
Description ATP-dependent DNA helicase II uvrD2 [Mycobacterium tuberculosis RGT
Sequence MSIASDPLIAGLDDQQREAVLAPRGPVCVLAGAGTGKTRTITHRIASLVA
SGHVAAGQVLAVTFTQRAAGEMRSRLRALDAAARTGSGVGAVQALTFHAA
AYRQLRYFWSRVIADTGWQLLDSKFAVVARAASRTRLHASTDDVRDLAGE
IEWAKASLIGPEEYVTAVAAARRDPPLDAAQIAAVYSEYEALKARGDGVT
LLDFDDLLLHTAAAIENDAAVAEEFQDRYRCFVVDEYQDVTPLQQRVLSA
WLGDRDDLTVVGDANQTIYSFTGASPRFLLDFSRRFPDAAVVRLERDYRS
TPQVVSLANRVIAAARGRVAGSKLRLSGQREPGPVPSFHEHSDEPAEAAT
VAASIARLIASGTPPSEVAILYRVNAQSEVYEEALTQAGIAYQVRGGEGF
FNRQEIKQALLALQRVSERDTDAALSDVVRAVLAPLGLTAQPPVGTRARE
RWEALTALAELVDDELAQRPALQLPGLLAELRRRAEARHPPVVQGVTLAS
LHAAKGLEWDAVFLVGLADGTLPISHALAHGPNSEPVEEERRLLYVGITR
ARVHLALSWALSRSPGGRQSRKPSRFLNGIAPQTRADPVPGTSRRNRGAA
ARCRICNNELNTSAAVMLRRCETCAADVDEELLLQLKSWRLSTAKEQNVP
AYVVFTDNTLIAIAELLPTDDAALIAIPGIGARKLEQYGSDVLQLVRGRT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo