Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309027
StrainMtb_RGTB327
Protein IDYP_005361838.1
Description piperideine-6-carboxylic acid dehydrogenase [Mycobacterium tubercul
Sequence MLEACQAIGVTAALGEPGEHSLPASTPITGDVLFSIAPTTPEQADHAIAA
AAATFTAWRSTPAPVRGALVARLGELLTAHQQDLATLVTVEVGKITAEAR
GEVQEMIDVCQFSVGLSRQLYGRTIASERAGHRLLETWHPLGVVGVITAF
NFPVAVWAWNTAVALVCGDTVVWKPSELTPLTALACQALLSRAAADVGAP
AAVGGLLLGGAERGAQLVDDPRVALLSATGSVRMGQQVGPRVARRFGRVL
LELGGNNAAIVAPSADLELAVRGIVFAAAGTAGQRCTSLRRLIVHRSVAD
DVVARVVGAYRQLAIGDPSAPDTLVGPLIHEAAYRDMVAALERARTDGGE
VIGGDRREVGSPGAYYVAPAVVRMPSQTAIVATETFAPILYVLTYDDLDE
AIALNNAVPQGLSSSIFTTDLREAEHFLDQSDCGIANVNIGTSGAEIGGA
FGGEKQTGGGRESGSDAWKAYMRRATNTVNYSSELPLAQGVKFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo