Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309067
StrainMtb_RGTB327
Protein IDYP_005361878.1
Description MerR family transcriptional regulator [Mycobacterium tuberculosis R
Sequence MKISEVAALTNTSTKTLRFYENSGLLPPPARTASGYRNYGPEIVDRLRFI
HRGQAAGLALQEVRQILAIHDRGEAPCAHVRQLLSTRIDEVRAQIAELIA
LEGHLQTLLDHASYGPPTEHDHSTVCWILESDLDEPTAIEVSDIHA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo