Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309135
StrainMtb_RGTB327
Protein IDYP_005361946.1
Description hypothetical protein MRGA327_21005 [Mycobacterium tuberculosis RGTB
Sequence MLAFPYLMTMITPPTFDVAFIGSGAACSMTLLEMADALLSSPSASPKLRI
AVVERDEQFWCGIPYGQRSSIGSLAIQKLDDFADEPEKAAYRIWLEQNKQ
RWLAFFQAEGGAAAARWICDNRDALDGNQWGELYLPRFLFGVFLSEQMIA
AIAALGERDLAEIVTIRAEAMSAHSADGHYRIGLRPSGNGPTAIAAGKVV
VAIGSPPTKAILASDSEPAFTYINDFYSPGGESNVARLRDSLDRVESWEK
RNVLVVGSNATSLEALYLMRHDARIRARVRSITVISRSGVLPYMICNQPP
EFDFPRLRTLLCTEAIAAADLMSAIRDDLATAEERSLNLADLYDAVAALF
GQALHKMDLVQQEEFFCVHGMNFTKLVRRAGRDCRQASEELAADGTLSLL
AGEVLRVDACASGQPFATMTYRAAGAEHTHPVPFAAVVNCGGFEELDTCS
SPFLVSAMQNGLCRPNRTNRGLLVNDDFEASPGFCVIGPLVGGNFTPKIR
FWHVESAPRVRSLAKSLAASLLASLQPVALAPC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)20
Vaccine TargetNo