Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309146
StrainMtb_RGTB327
Protein IDYP_005361957.1
Description RNA polymerase sigma factor SigD [Mycobacterium tuberculosis RGTB32
Sequence MTMQGERLDAVVAEAVAGDRNALREVLETIRPIVVRYCRARVGTVERSGL
SADDVAQEVCLATITALPRYRDRGRPFLAFLYGIAAHKVADAHRAAGRDR
AYPAETLPERWSADAGPEQMAIEADSVTRMNELLEILPAKQREILILRVV
VGLSAEETAAAVGSTTGAVRVAQHRALQRLKDEIVAAGDYA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo