Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309186
StrainMtb_RGTB327
Protein IDYP_005361997.1
Description 30S ribosomal protein S11 [Mycobacterium tuberculosis RGTB327]
Sequence MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGN
VIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQDHGVRKVDVFVKGPG
SGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo