Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309189
StrainMtb_RGTB327
Protein IDYP_005362000.1
Description translation initiation factor IF-1 infA [Mycobacterium tuberculosis
Sequence MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo