Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309215
StrainMtb_RGTB327
Protein IDYP_005362026.1
Description alpha- alpha-trehalose-phosphate synthase [Mycobacterium tuberculos
Sequence MAPSGGQEAQICDSETFGDSDFVVVANRLPVDLERLPDGSTTWKRSPGGL
VTALEPVLRRRRGARGRGGPGVNDDGAEPDLHVLDGPIIQDELELHPVRL
STTDIAQYYEGFSNATLWPLYHDVIVKPLYHREWWDRYVDVNQRFAEAAS
RAAAHGATVWVQDYQLQLVPKMLRMLRPDLTIGFFLHIPFPPVELFMQMP
WRTEIIQGLLGADLVGFHLPGGAQNFLILSRRLVGTDTSRGTVGVRSRFG
AAVLGSRTIRVGAFPISVDSGALDHAARDRNIRRRAREIRTELGNPRKIL
LGVDRLDYTKGIDVRLKAFSELLAEGRVKRDDTVVVQLATPSRERVESYQ
TLRNDIERQVGHINGEYGEVGHPVVHYLHRPAPRDELIAFFVASDVMLVT
PLRDGMNLVAKEYVACRSDLGGALVLSEFTGAAAELRHAYLVNPHDLEGV
KDGIEEALNQTEEAGRRRMRSLRRQVLAHDVDRWAQSFLDALAGAHPRGQ
G
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo