Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309217
StrainMtb_RGTB327
Protein IDYP_005362028.1
Description hypothetical protein MRGA327_21510 [Mycobacterium tuberculosis RGTB
Sequence MRRLISVAYALMVATIVGLSAAGGWFYWDRVQTGGEASARALLPKLAMQE
IPQVFGYDYQTVERSLTAVYPLLTPDYRQEFQKSANAQIIPEAKKREVVV
QANVVGVGVMDAKRDCASVMVYLNRTVTDKTRQPLYDGSRLRVDFQRIDG
KWLIAYITPI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo