Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309267
StrainMtb_RGTB327
Protein IDYP_005362078.1
Description acetaldehyde dehydrogenase [Mycobacterium tuberculosis RGTB327]
Sequence MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKL
GLETTHEGVDWLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTP
AAVGPAVIPPANLREHLGAPPSRNMITCGGQATIPIVYAVSRIVEVPYAE
IVASVASVSAGPGTRANIDEFTKTTARGVQTIGGAARGKAIIILNPADPP
MIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLLNEPQFDEPS
INSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVV
GGAR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo