Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309322
StrainMtb_RGTB327
Protein IDYP_005362133.1
Description hypothetical protein MRGA327_22170 [Mycobacterium tuberculosis RGTB
Sequence MGWIGDPIWLEEVLRPALGERLRVLDGWRERGHGDFRDIRGVMWHHTGNS
RETAKSIARGRPDLPGPLANLHIAHSGVVTIVAVGVCWHAGRGSYPWLPT
DNANWHMIGVECAWPTIRRDGSYDAGERWPDAQIVSMRDVAAALTLKLGY
GPERNIGHKEYAGAAQGKWDPGNLSMDWFRAEVAKDTRGEFDHPLTPPPA
VIARPPILPKPRNPRDDRILLEEVWDQLRGIEGRGWPVLGDKTIVDYLAE
LGNKVDALAAKLDAREGLDRPPSDTR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo