Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309345
StrainMtb_RGTB327
Protein IDYP_005362156.1
Description putative ESAT-6 like protein ESXV- partial [Mycobacterium tuberculo
Sequence MLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQ
TDSAVGSSWA
B cell epitope (IEDB)1
T cell epitope (IEDB)4
MHC binder (IEDB)0
Vaccine TargetNo