Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309387
StrainMtb_RGTB327
Protein IDYP_005362198.1
Description putative dipeptide-transport integral membrane protein ABC transpor
Sequence MIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGH
DIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVT
DVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEV
RASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATL
SYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMG
DALRDALDPASRAWRA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo