Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309396
StrainMtb_RGTB327
Protein IDYP_005362207.1
Description hypothetical protein MRGA327_22630 [Mycobacterium tuberculosis RGTB
Sequence MVATASSSGVVKSSSQYTCGNACAKARFIRRARRTKASRVSADQRPGTSA
ARAAGFDLDDFAAVTYDRVLIS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo