Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309411
StrainMtb_RGTB327
Protein IDYP_005362222.1
Description hypothetical protein MRGA327_22715 [Mycobacterium tuberculosis RGTB
Sequence MHKRYAPQRPKPDTETYIEKCTDRRQDGGHDERRQLLRPVSMLPPGYPVE
PPPVAPGYAPAGYPPYPATPPGYGPPGYGAPPSYGPPPGYGPPLGYPAAP
PGCGPPPGYGPPLGYGPPVAPGAVKPGIIPLRPLTLSDIFNGAVGYIRAN
PKATLGLTAMVVVTLQIISLVALFGPMTAFGDIVTGEPDELTGAVVGGWS
ASFGASLLVSWLAGVLLSGMLTVIVGRAVFGSPITVGEAWAKVRGRLLAL
FGLALLEAAGVVAVLGLAVVILSGVAAAANEAAAALLGFPLLLVVGVSLA
YLYVVLLFAPVLIVLERLPIVEAITRSFALVRHGFWRVLGIRLLTVLVVG
VVGNAIAAPFMIVGEIVTAVTASDGSVTMRLVGATLSAIGVTIGQIVTAP
FSAGVVVLLYTDRRIRAEAFDLVLQTGLEAGPAGGPAPVESTDNLWLTRA
FFKGS
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)11
Vaccine TargetNo