Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309435
StrainMtb_RGTB327
Protein IDYP_005362246.1
Description hypothetical protein MRGA327_22885 [Mycobacterium tuberculosis RGTB
Sequence MLISRMSVRSASMSVMGDVFIGSEAITAGRLTRHELQRWYQPMFRGVYVS
RRSVPTLWDRTVGAWLATRRHGVIAGNAASALHGAQWVDVDVAIELISPT
TRPQHGLVIRRETLCDDEITRVVGLPVTTLARTAYDLGRHLSRGEAVARL
DALMRATPFSRDDVLLLAKRHAGARGVRRLRDVLPLVDGGAASPKETWLR
LLLIDAGLPVPTTQIPVVHRWRNVGVLDMGWEKYMVAAEYDGDQHRSDRG
RYVKDQRRLRKLAELGWIVIRVIAEDNPDDVVNRVRAALLARGWRP
B cell epitope (IEDB)0
T cell epitope (IEDB)2
MHC binder (IEDB)0
Vaccine TargetNo