Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309457
StrainMtb_RGTB327
Protein IDYP_005362268.1
Description AraC family transcriptional regulator [Mycobacterium tuberculosis R
Sequence MSVVRGTALANYPSLVAGLGGDPATLLRAAGVRDQDVGNYDAFISIRAAI
RAIESAAAVTATMDFGRRLAQRQGIEILGPVGVAARTAATVGDALAIFNT
FMAAYSPVIAIRITPLAGQRSFIALEFLLDEPASYPQTMELALGVALGVI
RLLLGADYAPLAVHLPHDPLTPEAFYLQYFGCRPYFAERVGGFTMRTADL
SRPLNRDDVAHRVVVDYLSSITPLGEGIVESVRTIVRQLLPTGAATLNVV
AEQFHLHPKTLQRRLAEENTTFVILVDRVRKDVADRYLRTTGIGLTHLAR
ELGYAEQSVLTRSCKRWFGTGPAAYRNQARLQTTVSAPGSGRGPNPGNVS
VSC
B cell epitope (IEDB)1
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo