Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309465
StrainMtb_RGTB327
Protein IDYP_005362276.1
Description putative PE family protein (PE family-like protein) [Mycobacterium
Sequence MQSMSFDPAVADIGSQVVNNAFQGLQAGAVAWVSLSSLLPAGAEEVSAWA
VTAFTTAATGLLALNQAAQEELRKAGEVFTAIARMYSDADVRAAACLLEA
IPRPGQTLARE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo