Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309511
StrainMtb_RGTB327
Protein IDYP_005362322.1
Description indolylacetylinositol arabinosyltransferase [Mycobacterium tubercul
Sequence MGASFPLLPVNQTTATIFWPQGSTADGNITQITAPLVSGAPRALDISIPC
SAIATLPANGGLVLSTLPAGGVDTGKAGLFVRANPGHGRRGVPRLGGRGG
GPLHDRSGRL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo