Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309562
StrainMtb_RGTB327
Protein IDYP_005362373.1
Description superoxide dismutase [Fe] SODA [Mycobacterium tuberculosis RGTB327]
Sequence MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEA
RAKEDHSAILLNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIA
DAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNKLLIFQVYDHQTNFP
LGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYAAATSQ
TKGLIFG
B cell epitope (IEDB)0
T cell epitope (IEDB)9
MHC binder (IEDB)9
Vaccine TargetNo