Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 383309582 |
| Strain | Mtb_RGTB327 |
| Protein ID | YP_005362393.1 |
| Description | hypothetical protein MRGA327_23845 [Mycobacterium tuberculosis RGTB |
| Sequence | MEKMSHDPIAADIGTQVSDNALHGVTAGSTALTSVTGLVPAGADEVSAQA ATAFTSEGIQLLASNASAQDQLHRAGEAVQDVARTYSQIDDGAAGVFA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 3 |
| MHC class II prediction (Propred) | 4 |
| MHC class 1 prediction (Propred1) | 56 |
| CTL epitope prediction (CTLpred) | 5 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
| Prediction of IL4 inducing peptides (IL4pred) | 33 |