Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309593
StrainMtb_RGTB327
Protein IDYP_005362404.1
Description hypothetical protein MRGA327_23950 [Mycobacterium tuberculosis RGTB
Sequence MTNPWNDPNMLDDGAVGRGDPSVRHHFRDSVSDTMRITDLAAPRKIPPGT
GWRKFVYSVSFHKINPGESPRERHYRNLQGRIRRHIRRQYVITVVSGKGG
VGVTTMAACIGGVFRECRPENVIAIDAVPSFGTLADRIDESPPGDYAAII
NDTDVQGYADIREHLGQNTVGLDVLAGNRTSDQPRPLVPAMFSAVLSRLR
RTHTVIVIDTSPDLEHDVMKAVLQSTDTLVFVSGITADRSRPVLRAVDYL
RAQGYHELVSRSTVILNHTDSITDKDALAYLTERFTKVGAIVEAMPFDPH
LAKGGIIDTVHELNKKSRLRLFEITAGLADKYVPDAERAAQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)4
Vaccine TargetYes
B cell prediction (LBtope)22
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)230
CTL epitope prediction (CTLpred)64
Prediction of interferon-gamma inducing peptides (IFNepitope)144
Prediction of IL4 inducing peptides (IL4pred)238