Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309595
StrainMtb_RGTB327
Protein IDYP_005362406.1
Description esat-6 like protein EsxD [Mycobacterium tuberculosis RGTB327]
Sequence MADTIQVTPQMLRSTANDIQANMEQAMGIAKGYLANQENVMNPATWSGTG
VVASHMTATEITNELNKVLTGGTRLAEGLVQAAALMEGHEADSQTAFQAL
FGASHGS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo