Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309624
StrainMtb_RGTB327
Protein IDYP_005362435.1
Description 50S ribosomal protein L34 [Mycobacterium tuberculosis RGTB327]
Sequence MTKGKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTLSA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo