Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385989968
StrainMtb_CCDC5180
Protein IDYP_005908266.1
Description mycolic acid synthase [Mycobacterium tuberculosis CCDC5180]
Sequence MSVQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQI
AKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQA
GHVQKMFDQMDTPRSRRVLLEGWEKFDEPVDRIVSIGAFEHFGHQRYHHF
FEVTHRTLPADGKMLLHTIVRPTFKEGREKGLTLTHELVHFTKFILAEIF
PGGWLPSIPTVHEYAEKVGFRVTAVQSLQLHYARTLDMWATALEANKDQA
IAIQSQTVYDRYMKYLTGCAKLFRQGYTDVDQFTLEK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)32
MHC class II prediction (Propred)41
MHC class 1 prediction (Propred1)203
CTL epitope prediction (CTLpred)35
Prediction of interferon-gamma inducing peptides (IFNepitope)129
Prediction of IL4 inducing peptides (IL4pred)244