Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385989973
StrainMtb_CCDC5180
Protein IDYP_005908271.1
Description iron-regulated heparin binding hemagglutinin hbhA [Mycobacterium tu
Sequence MKGIPMAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTD
TRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRY
NELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTR
AVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKK
VTQK
B cell epitope (IEDB)6
T cell epitope (IEDB)0
MHC binder (IEDB)6
Vaccine TargetYes
B cell prediction (LBtope)25
MHC class II prediction (Propred)13
MHC class 1 prediction (Propred1)146
CTL epitope prediction (CTLpred)28
Prediction of interferon-gamma inducing peptides (IFNepitope)123
Prediction of IL4 inducing peptides (IL4pred)108