Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385989986
StrainMtb_CCDC5180
Protein IDYP_005908284.1
Description two component system sensor histidine kinase senX3 [Mycobacterium t
Sequence MTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSGITVSQ
MLQCIVTLMPLGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQ
ALGGEDVEFDLSPRKRSATGRSGLSVHGHARLLSEEDRRFAVVFVHDQSD
YARMEAARRDFVANVSHELKTPVGAMALLAEALLASADDSETVRRFAEKV
LIEANRLGDMVAELIELSRLQGAERLPNMTDVDVDTIVSEAISRHKVAAD
NADIEVRTDAPSNLRVLGDQTLLVTALANLVSNAIAYSPRGSLVSISRRR
RGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVK
HVAANHDGTIRVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRSN
RSQREEELSR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)17
MHC class II prediction (Propred)59
MHC class 1 prediction (Propred1)277
CTL epitope prediction (CTLpred)80
Prediction of interferon-gamma inducing peptides (IFNepitope)175
Prediction of IL4 inducing peptides (IL4pred)263