Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385990946
StrainMtb_CCDC5180
Protein IDYP_005909244.1
Description polyketide synthase pks2 [Mycobacterium tuberculosis CCDC5180]
Sequence MGCRLPGGIDSPDRLWEALLRGDDLVTEIPADRWDIDEYYDPEPGVPGRT
DCKWGAYLDNVGDFDPEFFGIGEKEAIAIDPQHRLLLETSWEAMEHGGLT
PNQMASRTGVFVGLVHTDYILVHADNQTFEGPYGNTGTNACFASGRVAYA
MGLQGPAITVDTACSSGLTAIHLACRSLHDGESDIALAGGVYVMLEPRRF
ASGSALGMLSATGRCHAFDVSADGFVSGEGCVMLALKRLPDALADGDRIL
AVIRGTAANQDGHTVNIATPSRSAQVAAYREALDVAGVDPATVGMVEAHG
PGTPVGDPIEYASLAEVYGNDGPCALASVKTNFGHTQSAAGALGLMKAVL
ALQHGVVPQNLHFTALPDKLAAIETNLFVPQEITPWPGADQETPRRAAVS
SYGMTGTNVHAIVEQAPVPAPESGAPGDTPATPGIDGALLFALSASSQDA
LRQTAARLADWVDAQGPELAPADLAYTLARRRGHRPVRTAVLAATTAELT
EALREVATGEPPYPPAVGQDDRGPVWVFSGQGSQWAGMGADLLATEPVFA
ATIAAIEPLIAAESGFSVTEAMTAPEVVTGIDRVQPTLFAMQVALAATMK
SYGVAPGAVIGHSLGESAAAVVAGALCLEDGVRVICRRSALMTRIAGAGA
MASVELPAQQVLSELMARGVNDAVVAVVASPQSTVIGGATQTVRDLVAAW
EQRDVLAREVAVDVASHSPQVDPILDELAEALAEISPLQPEIPYYSATSF
DPREEPYCDAYYWVDNLRHTVRFAAAVQAALEDGYRVFTELTPHPLLTHA
VDQTARSLDMSAAALAGMRREQPLPHGLRALAGDLYAAGAAVDFAVLYPT
GRLINAPLPTWNHRRLLLDDTTRRIAHANTVAVHPLLGSHVRLPEEPERH
VWQGEVGTVTQPWLADHQIHGAAALPGAAYCEMALAAARAVLGEASEVRD
IRFEQMLLLDDETPIGVTATVEAPGVVPLTVETSHDGRYTRQLAAVLHVV
READDAPDQPPQKNIAELLASHPHKVDGAEVRQWLDKRGHRLGPAFAGLV
DAYIAEGAGDTVLAEVNLPGPLRSQVKAYGVHPVLLDACFQSVAAHPAVQ
GMADGGLLLPLGVRRLRSYGSARHARYCCTTVTACGVGVEADLDVLDEHG
AVVLAVRGLQLGTGASQASERARVLGERLLSIEWHERELPENSHAEPGAW
LLISTCDATDLVAAQLTDALKVHDAQCTTMSWPQRADHAAQAARLRDQLG
TGGFTGVFVLTAPQTGDPDAESPVRGGELVKHVVRIAREIPEITAQEPRL
YVLTHNAQAVLSGDRPNLEQGGMRGLLRVIGAEHPHLKASYVDVDEQTGA
ESVARQLLAASGEDETAWRNDQWYTARLCPAPLRPEERQTTVVDHAEAGM
RLQIRTPGDLQTLEFAAFDRVPPGPGEIEVAVTASSINFADVLVTFGRYQ
TLDGRQPQLGTDFAGVVSAVGPGVSELKVGDRVGGMSPNGCWATFVTCDA
RLATRLPEGLTDAQAAAVTTASATAWYGLQDLARIKAGDKVLIHSATGGV
GQAAIAIARAAGAQIYATAGNEKRRDLLRDMGIEHVYDSRSVEFAEQIRR
DTAGYGVDIVLNSVTGAAQLAGLKLLALGGRFIEIGKRDIYSNTRLELLP
FRRNLAFYGLDLGLMSVSHPAAVRELLSTVYRLTVEGVLPMPQSTHYPLA
EAATAIRVMGAAEHTGKLILDVPHAGRSSVVLPPEQARVFRSDGSYIITG
GLGGLGLFLAEKMANAGAGRIVLSSRSQPSQKALETIELVRAIGSDVVVE
CGDIAQPDTADRLVTAATATGLPLRGVLHAAAVVEDATLANITDELIERD
WAPKAYGAWQLHRATADQPLDWFCSFSSAAALVGSPGQGAYAAANSWLDT
FTHWRRAQDLPATSIAWGAWGQIGRAIAFAEQTGDAIAPEEGAYAFETLL
RHNRAYSGYAPVIGSPWLTAFAQHSPFAEKFQSLGQNRSGTSKFLAELVD
LPREEWPDRLRRLLSKQVGLILRRTIDTDRLLSEYGLDSRSSQELRARVE
AETGIRISATEINTTVRGLADLMCDKLAADRDAPAPA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)168
MHC class II prediction (Propred)273
MHC class 1 prediction (Propred1)1416
CTL epitope prediction (CTLpred)309
Prediction of interferon-gamma inducing peptides (IFNepitope)816
Prediction of IL4 inducing peptides (IL4pred)1385