Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385991678
StrainMtb_CCDC5180
Protein IDYP_005909976.1
Description membrane-associated phospholipase C 2 plcB [Mycobacterium tuberculo
Sequence MGSEHPVDGMTRRQFFAKAAAATTAGAFMSLAGPIIEKAYGAGPCPGHLT
DIEHIVLLMQENRSFDHYFGTLSDTRGFDDTTPPVVFAQSGWNPMTQAVD
PAGVTLPYRFDTTRGPLVAGECVNDPDHSWIGMHNSWNGGANDNWLPAQV
PFSPLQGNVPVTMGFYTRRDLPIHYLLADTFTVCDGYFCSLLGGTTPNRL
YWMSAWIDPDGTDGGPVLIEPNIQPLQHYSWRIMPENLEDAGVSWKVYQN
KLLGALNNTVVGYNGLVNDFKQAADPRSNLARFGISPTYPLDFAADVRNN
RLPKVSWVLPGFLLSEHPAFPVNVGAVAIVDALRILLSNPAVWEKTALIV
NYDENGGFFDHVVPPTPPPGTPGEFVTVPDIDSVPGSGGIRGPIGLGFRV
PCLVISPYSRGPLMVHDTFDHTSTLKLIRARFGVPVPNLTAWRDATVGDM
TSTFNFAAPPNPSKPNLDHPRLNALPKLPQCVPNAVLGTVTKTAIPYRVP
FPQSMPTQETAPTRGIPSGLC
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)119
MHC class II prediction (Propred)148
MHC class 1 prediction (Propred1)683
CTL epitope prediction (CTLpred)124
Prediction of interferon-gamma inducing peptides (IFNepitope)297
Prediction of IL4 inducing peptides (IL4pred)750