Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385991751
StrainMtb_CCDC5180
Protein IDYP_005910049.1
Description PPE family protein [Mycobacterium tuberculosis CCDC5180]
Sequence MHFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLL
SLMDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAH
HDMVPLAQIYNNRAERQILIDNNALGQFTAQIADLDQEYDDFWDEDGEVM
RDYRLRVSDALSKLTPWKAPPPIAHSTVLVAPVSPSTASSRTDT
B cell epitope (IEDB)1
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)30
MHC class 1 prediction (Propred1)130
CTL epitope prediction (CTLpred)30
Prediction of interferon-gamma inducing peptides (IFNepitope)61
Prediction of IL4 inducing peptides (IL4pred)110