Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385992205
StrainMtb_CCDC5180
Protein IDYP_005910503.1
Description polyketide synthase [Mycobacterium tuberculosis CCDC5180]
Sequence MSVEGADQQSEKLFHYLKKVAVELDETRARLREYEQRATEPVAVVGIGCR
FPGGVDGPDGLWDVVSAGRDVVSEFPTDRGWDVEGLYDPDPDAEGKTYTR
WGAFLDDATGFDAGFFGIAPSEVLAMDPQQRLMLEVSWEALEHAGIDPLS
LRGSATGVYTGIFAASYGNRDTGGLQGYGLTGTSISVASGRVSYVLGLQG
PAVSVDTACSSSLVAIHWAMSSLRSGECDLALAGGVTVMGLPSIFVGFSR
QRGLAADGRCKAFAAAADGTGWGEGAGVVVLERLSDARRLGHSVLAVVRG
SAVNQDGASNGLTAPNGLAQQRVIQAALANAGLSAADVDVVEAHGTATTL
GDPIEAQALLSTYGQGGPAEQPLWVGSIKSNMGHTQAAAGVAGVIKMVQA
MRHGVMPATLHVDEPSPRVDWTSGAVSVLTEAREWSVDGRPRRAAVSSFG
ISGTNAHLILEEAPVPAPAEAPVEASEKPGAAGRGRRWCRG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)40
MHC class II prediction (Propred)62
MHC class 1 prediction (Propred1)316
CTL epitope prediction (CTLpred)66
Prediction of interferon-gamma inducing peptides (IFNepitope)258
Prediction of IL4 inducing peptides (IL4pred)335