Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385993449
StrainMtb_CCDC5079
Protein IDYP_005911747.1
Description transcriptional regulator [Mycobacterium tuberculosis CCDC5079]
Sequence MTISFSSSNLRDDATSGNGDYRLDKLPETTPSTSVFDRADVTYRQFTELH
GQARDTRREAHVVELESKTGERARCAPMHALEQLADYGFAWRDIARVVGV
SVPAITKWRKGAGVTGENRLKIARLLALIDMLSDRFIGEPASWLEMPIQA
GVGITRMDLLERGRYDLVLALASTHTGDGTVEYVLNETDKDWRETVVDNA
FESYTAEDGVISIRPKR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)15
MHC class II prediction (Propred)28
MHC class 1 prediction (Propred1)149
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)76
Prediction of IL4 inducing peptides (IL4pred)184