Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385993454
StrainMtb_CCDC5079
Protein IDYP_005911752.1
Description MerR family transcriptional regulator [Mycobacterium tuberculosis C
Sequence MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRY
SLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELA
VLRANQRREVAVVPKSTALVVWKPRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)19
MHC class 1 prediction (Propred1)87
CTL epitope prediction (CTLpred)27
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)61