Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385993585
StrainMtb_CCDC5079
Protein IDYP_005911883.1
Description two component sensory transduction protein RegX3 [Mycobacterium tub
Sequence MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVL
LDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGGDDDSEMSDGVLESGPVRMDVERHVVSVNGD
TITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKR
LRSKIEADPANPVHLVTVRGLGYKLEG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)21
MHC class II prediction (Propred)37
MHC class 1 prediction (Propred1)155
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)67
Prediction of IL4 inducing peptides (IL4pred)168