Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385994019
StrainMtb_CCDC5079
Protein IDYP_005912317.1
Description metal cation transporting P-type ATPase ctpV [Mycobacterium tubercu
Sequence MTTDVLSDTDVSLKVVSNASGRMRVCVTGFNVDAVRAVAIEETVSQVTGV
HAVHAYPRTASVVIWYSPELGDTAAVLSAITKAQHVPAELVPARAPHSAG
VRGVGVVRKITGGIRRMLSRPPGVDKPLKASRCGGRPRGPVRGSASWPGE
QNRRERRTWLPRVWLALPLGLLALGSSMFFGAYPWAGWLAFAATLPVQFV
AGWPILRGAVQQARALTSNMDTLIALGTLTAFVYSTYQLFAGGPLFFDTS
ALIIAFVVLGRHLEARATGKASEAISKLLELGAKEATLLVDGQELLVPVD
QVQVGDLVRVRPGEKIPVDGEVTDGRAAVDESMLTGESVPVEKTAGDRVA
GATVNLDGLLTVRATAVGADTALAQIVRLVEQAQGDKAPVQRLADRVSAV
FVPAVIGVAVATFAGWTLIAANPVAGMTAAVAVLIIACPCALGLATPTAI
MVGTGRGAELGILVKGGEVLEASKKIDTVVFDKTGTLTRARMRVTDVIAG
QRRQPNQVLRLAAAVESGSEHPIGAAIVAAAHERGLAIPAANAFTAVAGH
GVRAQVNGGPVVVGRRKLVDEQHLVLPDHLAAAAVEQEERGRTAVFVGQD
GQVVGVLAVADTVKDDAADVVGRLHAMGLQVAMITGDNARTAAAIAKQVG
IEKVLAEVLPQDKVAEVRRLQDQGRVVAMVGDGVNDAPALVQADLGIAIG
TGTDVAIEASDITLMSGRLDGVVRAIELSRQTLRTIYQNLGWAFGYNTAA
IPLAALGALNPVVAGAAMGFSSVSVVTNSLRLRRFGRDGRTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)53
MHC class II prediction (Propred)133
MHC class 1 prediction (Propred1)560
CTL epitope prediction (CTLpred)139
Prediction of interferon-gamma inducing peptides (IFNepitope)374
Prediction of IL4 inducing peptides (IL4pred)479