Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385994804
StrainMtb_CCDC5079
Protein IDYP_005913102.1
Description preprotein translocase subunit SecA [Mycobacterium tuberculosis CCD
Sequence MPKTTRAQPGRLSSRFWRLLGASTEKNRSRSLADVTASAEYDKEAADLSD
EKLRKAAGLLNLDDLAESADIPQFLAIAREAAERRTGLRPFDVQLLGALR
MLAGDVIEMATGEGKTLAGAIAAAGYALAGRHVHVVTINDYLARRDAEWM
GPLLDAMGLTVGWITADSTPDERRTAYDRDVTYASVNEIGFDVLRDQLVT
DVNDLVSPNPDVALIDEADSVLVDEALVPLVLAGTTHRETPRLEIIRLVA
ELVGDKDADEYFATDSDNRNVHLTEHGARKVEKALGGIDLYSEEHVGTTL
TEVNVALHAHVLLQRDVHYIVRDDAVHLINASRGRIAQLQRWPDGLQAAV
EAKEGIETTETGEVLDTITVQALINRYATMCGMTGTALAAGEQLRQFYQL
GVSPIPPNKPNIREDEADRVYITTAAKNDGIVEHITEVHQRGQPVLVGTR
DVAESEELHERLVRRGVPAVVLNAKNDAEEARVIAEAGKYGAVTVSTQMA
GRGTDIRLGGSDEADHDRVAELGGLHVVGTGRHHTERLDNQLRGRAGRQG
DPGSSVFFSSWEDDVVAANLDHNKLPMATDENGRIVSPRTGSLLDHAQRV
AEGRLLDVHANTWRYNQLIAQQRAIIVERRNTLLRTVTAREELAELAPKR
YEELSDKVSEERLETICRQIMLYHLDRGWADHLAYLADIRESIHLRALGR
QNPLDEFHRMAVDAFASLAADAIEAAQQTFETANVLDHEPGLDLSKLARP
TSTWTYMVNDNPLSDDTLSALSLPGVFR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)75
MHC class II prediction (Propred)92
MHC class 1 prediction (Propred1)534
CTL epitope prediction (CTLpred)136
Prediction of interferon-gamma inducing peptides (IFNepitope)315
Prediction of IL4 inducing peptides (IL4pred)491