Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385994889
StrainMtb_CCDC5079
Protein IDYP_005913187.1
Description catalase-peroxidase-peroxynitritase T KATG [Mycobacterium tuberculo
Sequence MGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGAAFDYAAEVATID
VDALTRDIEEVMTTSQPWWPADYGHYGPLFIRMAWHAAGTYRIHDGRGGA
GGGMQRFAPLNSWPDNASLDKARRLLWPVKKKYGKKLSWADLIVFAGNCA
LESMGFKTFGFGFGRVDQWEPDEVYWGKEATWLGDERYSGKRDLENPLAA
VQMGLIYVNPEGPNGNPDPMAAAVDIRETFRRMAMNDVETAALIVGGHTF
GKTHGAGPADLVGPEPEAAPLEQMGLGWKSSYGTGTGKDAITSGIEVVWT
NTPTKWDNSFLEILYGYEWELTKSPAGAWQYTAKDGAGAGTIPDPFGGPG
RSPTMLATDLSLRVDPIYERITRRWLEHPEELADEFAKAWYKLIHRDMGP
VARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQILASGLTVSQL
VSTAWAAASSFRGSDKRGGANGGRIRLQPQVGWEVNDPDGDLRKVIRTLE
EIQESFNSAAPGNIKVSFADLVVLGGCAAIEKAAKAAGHNITVPFTPGRT
DASQEQTDVESFAVLEPKADGFRNYLGKGNPLPAEYMLLDKANLLTLSAP
EMTVLVGGLRVLGANYKRLPLGVFTEASESLTNDFFVNLLDMGITWEPSP
ADDGTYQGKDGSGKVKWTGSRVDLVFGSNSELRALVEVYGADDAQPKFVQ
DFVAAWDKVMNLDRFDVR
B cell epitope (IEDB)0
T cell epitope (IEDB)4
MHC binder (IEDB)4
Vaccine TargetYes
B cell prediction (LBtope)41
MHC class II prediction (Propred)91
MHC class 1 prediction (Propred1)486
CTL epitope prediction (CTLpred)95
Prediction of interferon-gamma inducing peptides (IFNepitope)316
Prediction of IL4 inducing peptides (IL4pred)563