Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385995297
StrainMtb_CCDC5079
Protein IDYP_005913595.1
Description phospholipase C 3 plcC [Mycobacterium tuberculosis CCDC5079]
Sequence MSRRAFLAKAAGAGAAAVLTDWAAPVIEKAYGAGPCSGHLTDIEHIVLCL
QENRSFDHYFGTLSAVDGFDTPTPLFQQKGWNPETQALDPTGITLPYRIN
TTGGPNGVGECVNDPDHQWIAAHLSWNGGANDGWLPAQARTRSVANTPVV
MGYYARPDIPIHYLLADTFTICDQYFSSLLGGTMPNRLYWISATVNPDGD
QGGPQIVEPAIQPKLTFTWRIMPQNLSDAGISWKVYNSKLLGGLNDTSLS
RNGYVGSFKQAADPRSDLARYGIAPAYPWDFIRDVINNTLPQVSWVVPLT
VESEHPSFPVAVGAVTIVNLIRVLLRNPAVWEKTALIIAYDEHGGFFDHV
TPLTAPEGTPCEWIPNSVDIDKVDGSGGIRGPIGLGFRVPCFVISPYSRG
GLMVHDRFDHTSQLQLIGKRFGVPVPNLTPWRASVTGDMTSAFNFAAPPD
PSPPNLDHPVRQLPKVAKCVPNVVLGFLNEGLPYRVPYPQTTPVQESGPA
RPIPSGIC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)128
MHC class II prediction (Propred)126
MHC class 1 prediction (Propred1)637
CTL epitope prediction (CTLpred)132
Prediction of interferon-gamma inducing peptides (IFNepitope)345
Prediction of IL4 inducing peptides (IL4pred)715