Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385995299
StrainMtb_CCDC5079
Protein IDYP_005913597.1
Description membrane-associated phospholipase C 1 plcA [Mycobacterium tuberculo
Sequence MDWAAPVIEKAYGAGPCPGHLTDIEHIVLLMQENRSFDHYFGTLSSTNGF
NAASPAFQQMGWNPMTQALDPAGVTIPFRLDTTRGPFLDGECVNDPEHQW
VGMHLAWNGGANDNWLPAQATTRAGPYVPLTMGYYTRQDIPIHYLLADTF
TICDGYHCSLLTGTLPNRLYWLSANIDPAGTDGGPQLVEPGFLPLQQFSW
RIMPENLEDAGVSWKVYQNKGLGRFINTPISNNGLVQAFRQAADPRSNLA
RYGIAPTYPGDFAADVRANRLPKVSWLVPNILQSEHPALPVALGAVSMVT
ALRILLSNPAVWEKTALIVSYDENGGFFDHVTPPTAPPGTPGEFVTVPNI
DAVPGSGGIRGPLGLGFRVPCIVISPYSRGPLMVSDTFDHTSQLKLIRAR
FGVPVPNMTAWRDGVVGDMTSAFNFAAPPNSTRPNLSHPLLGALPKLPQC
IPNVVLGTTDGALPSIPYRVPYPQVMPTQETTPVRGTPSGLCS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)56
MHC class II prediction (Propred)72
MHC class 1 prediction (Propred1)310
CTL epitope prediction (CTLpred)59
Prediction of interferon-gamma inducing peptides (IFNepitope)158
Prediction of IL4 inducing peptides (IL4pred)341