Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385996286
StrainMtb_CCDC5079
Protein IDYP_005914584.1
Description transcriptional regulatory protein WHIB-like WHIB3 [Mycobacterium t
Sequence MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAK
EMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRR
TA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)8
MHC class 1 prediction (Propred1)65
CTL epitope prediction (CTLpred)16
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)74