Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385996477
StrainMtb_CCDC5079
Protein IDYP_005914775.1
Description hypothetical protein [Mycobacterium tuberculosis CCDC5079]
Sequence MSRAFIIDPTISAIDGLYDLLGIGIPNQGGILYSSLEYFEKALEELAAAF
PGDGWLGSAADKYAGKNRNHVNFFQELADLDRQLISLIHDQANAVQTTRD
ILEGAKKGLEFVRPVAVDLTYIPVVGHALSAAFQAPFCAGAMAVVGGALA
YLVVKTLINATQLLKLLAKLAELVAAAIADIISDVADIIKGILGEVWEFI
TNALNGLKELWDKLTGWVTGLFSRGWSNLESFFAGVPGLTGATSGLSQVT
GLFGAAGLSASSGLAHADSLASSASLPALAGIGGGSGFGGLPSLAQVHAA
STRQALRPRADGPVGAAAEQVGGQSQLVSAQGSQGMGGPVGMGGMHPSSG
ASKGTTTKKYSEGAAAGTEDAERAPVEADAGGGQKVLVRNVV
B cell epitope (IEDB)0
T cell epitope (IEDB)4
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)48
MHC class II prediction (Propred)44
MHC class 1 prediction (Propred1)247
CTL epitope prediction (CTLpred)47
Prediction of interferon-gamma inducing peptides (IFNepitope)200
Prediction of IL4 inducing peptides (IL4pred)210