Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385996676
StrainMtb_CCDC5079
Protein IDYP_005914975.1
Description integral membrane transport protein [Mycobacterium tuberculosis CCD
Sequence MVIAFWVALAGLLAPTVPSLDAISQRHPVAILPSDAPVLVSTRQMTAAFR
EAGLQSVAVVVLSDAKGLGAADERSYKELVDALRRDTRDVVMLQDFVTTP
PLRELMTSKDNQAWILPVGLPGDLGSTQSKQAYARVADIVEHQVAGSTLT
ANLTGPAATVADLNLTGQRDRSRIEFAITILLLVILLIIYGNPITMVLPL
ITIGMSVVVAQRLVAIAGLAGLGIANQSIIFMSGMMVGAGTDYAVFLISR
YHDYLRQGADSDQAVKKALTSIGKVIAASAATVAITFLGMVFTQLGILKT
VGPMLGISVAVVFFAAVTLLPALMVLTGRRGWIAPRRDLTRRFWRSSGVH
IVRRPKTHLLASALVLVILAGCAGLARYNYDDRKTLPASVESSIGYAALD
KHFPSNLIIPEYLFIQSSTDLRTPKALADLEQMVQRVSQVPGVAMVRGIT
RPAGRSLEQARTSWQAGEVGSKLDEGSKQIAVHTGDIDKLAGGANLMASK
LGDVRAQVNRAISTVGGLIDALAYLQDLLGGNRVLGELEGAEKLIGSMRA
LGDTIDADASFVANNTEWASPVLGALDSSPMCTADPACASARTELQRLVT
ARDDGTLAKISELARQLQATRAVQTLAATVSGLRGALATVIRAMGSLGMS
SPGGVRSKINLVNKGVNDLADGSRQLAEGVQLLVDQVKKMGFGLGEASAF
LLAMKDTATTPAMAGFYIPPELLSYATGESVKAETMPSEYRDLLGGLNVD
QLKKVAAAFISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGAQPNT
ALADAKVSVVGLPVVLKDTRDYSDHDLRLIIAMTVCIVLLILIVLLRAIV
APLYLIGSVIVSYLAALGIGVIVFQFLLGQEMHWSIPGLTFVILVAVGAD
YNMLLISRLREEAVLGVRSGVIRTVASTGGVITAAGLIMAASMYGLVFAS
LGSVVQGAFVLGTGLLLDTFLVRTVTVPAIAVLVGQANWWLPSSWRPATW
WPLGRRRGRAQRTKRKPLLPKEEEEQSPPDDDDLIGLWLHDGLRL
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)67
MHC class II prediction (Propred)211
MHC class 1 prediction (Propred1)744
CTL epitope prediction (CTLpred)187
Prediction of interferon-gamma inducing peptides (IFNepitope)389
Prediction of IL4 inducing peptides (IL4pred)620