Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385998044
StrainMtb_CTRI-2
Protein IDYP_005916342.1
Description unnamed protein product [Mycobacterium tuberculosis CTRI-2]
Sequence MDISRWLERHVGVQLLRLHDAIYRGTNGRIGHRIPGAPPSLLLHTTGAKT
SQPRTTSLTYARDGDAYLIVASKGGDPRSPGWYHNLKANPDVEINVGPKR
FGVTAKPVQPHDPDYARLWQIVNENNANRYTNYQSRTSRPIPVVVLTRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)21
MHC class 1 prediction (Propred1)99
CTL epitope prediction (CTLpred)32
Prediction of interferon-gamma inducing peptides (IFNepitope)34
Prediction of IL4 inducing peptides (IL4pred)95