Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385999715
StrainMtb_CTRI-2
Protein IDYP_005918014.1
Description fadD26 gene product [Mycobacterium tuberculosis CTRI-2]
Sequence MPVTDRSVPSLLQERADQQPDSTAYTYIDYGSDPKGFADSLTWSQVYSRA
CIIAEELKLCGLPGDRVAVLAPQGLEYVLAFLGALQAGFIAVPLSTPQYG
IHDDRVSAVLQDSKPVAILTTSSVVGDVTKYAASHDGQPAPVVVEVDLLD
LDSPRQMPAFSRQHTGAAYLQYTSGSTRTPAGVIVSHTNVIANVTQSMYG
YFGDPAKIPTGTVVSWLPLYHDMGLILGICAPLVARRRAMLMSPMSFLRR
PARWMQLLATSGRCFSAAPNFAFELAVRRTSDQDMAGLDLRDVVGIVSGS
ERIHVATVRRFIERFAPYNLSPTAIRPSYGLAEATLYVAAPEAGAAPKTV
RFDYEQLTAGQARPCGTDGSVGTELISYGSPDPSSVRIVNPETMVENPPG
VVGEIWVHGDHVTMGYWQKPKQTAQVFDAKLVDPAPAAPEGPWLRTGDLG
VISDGELFIMGRIKDLLIVDGRNHYPDDIEATIQEITGGRAAAIAVPDDI
TEQLVAIIEFKRRGSTAEEVMLKLRSVKREVTSAISKSHSLRVADLVLVS
PGSIPITTSGKIRRSACVERYRSDGFKRLDVAV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)25
MHC class II prediction (Propred)94
MHC class 1 prediction (Propred1)409
CTL epitope prediction (CTLpred)97
Prediction of interferon-gamma inducing peptides (IFNepitope)200
Prediction of IL4 inducing peptides (IL4pred)434