Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386003282
StrainMtb_RGTB423
Protein IDYP_005921561.1
Description zinc metalloprotease [Mycobacterium tuberculosis RGTB423]
Sequence MTLAIPSGIDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATDGAFRS
LFDRAETQVRDLIIQASQAGAAVGTDAQRIGDLYASFLDEEAVERAGVQP
LHDELATIDSAADATELAAALGTLQRAGVGGGIGVYVDTDSKDSTRYLVH
FTQSGIGLPDESYYRDEQHAAVLAAYPGHIARMFGLVYGGESRDHAKTAD
RIVALETKLADAHWDVVKRRDADLGYNLRTFAQLQTEGAGFDWVSWVTAL
GSAPDAMTELVVRQPDYLVTFASLWASVNVEDWKCWARWRLIRARAPWLT
RALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAVGKLYVQRHFP
PDAKSRIDTLVDNLQEAYRISISELDWMTPQTRQRALAKLNKFTAKVGYP
IKWRDYSKLAIDRDDLYGNVQRGYAVNHDRELAKLFGPVDRDEWFMTPQT
VNAYYNPGMNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFD
DQGAKYDGDGNLVDWWTDDDRTEFAARTKALIEQYHAYTPRDLVDHPGPP
HVQGAFTIGENIGDLGGLSIALLAYQLSLNGNPAPVIDGLTGMQRVFFGW
AQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRNVDAFYQAFDVTGG
B cell epitope (IEDB)0
T cell epitope (IEDB)2
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)59
MHC class II prediction (Propred)92
MHC class 1 prediction (Propred1)445
CTL epitope prediction (CTLpred)109
Prediction of interferon-gamma inducing peptides (IFNepitope)289
Prediction of IL4 inducing peptides (IL4pred)409