Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386003974
StrainMtb_RGTB423
Protein IDYP_005922253.1
Description ATPase P [Mycobacterium tuberculosis RGTB423]
Sequence MRVCVTGFNVDAVRAVAIEETVSQVTGVHAVHAYPRTASVVIWYSPELGD
TAAVLSAITKAQHVPAELVPARAPHSAGVRGVGVVRKITGGIRRMLSRPP
GVDKPLKASRCGGRPRGPVRGSASWPGEQNRRERRTWLPRVWLALPLGLL
ALGSSMFFGAYPWAGWLAFAATLPVQFVAGWPILRGAVQQARALTSNMDT
LIALGTLTAFVYSTYQLFAGGPLFFDTSALIIAFVVLGRHLEARATGKAS
EAISKLLELGAKEATLLVDGQELLVPVDQVQVGDLVRVRPGEKIPVDGEV
TDGRAAVDESMLTGESVPVEKTAGDRVAGATVNLDGLLTVRATAVGADTA
LAQIVRLVEQAQGDKAPVQRLADRVSAVFVPAVIGVAVATFAGWTLIAAN
PVAGMTAAVAVLIIACPCALGLATPTAIMVGTGRGAELGILVKGGEVLEA
SKKIDTVVFDKTGTLTRARMRVTDVIAGQRRQPNQVLRLAAAVESGSEHP
IGAAIVAAAHERGLAIPAANAFTAVAGHGVRAQVNGGPVVVGRRKLVDEQ
HLVLPDHLAAAAVEQEERGRTAVFVGQDGQVVGVLAVADTVKDDAADVVG
RLHAMGLQVAMITGDNARTAAAIAKQVGIEKVLAEVLPQDKVAEVRRLQD
QGRVVAMVGDGVNDAPALVQADLGIAIGTGTDVAIEASDITLMSGRLDGV
VRAIELSRQTLRTIYQNLGWAFGYNTAAIPLAALGALNPVVAGAAMGFSS
VSVVTNSLRLRRFGRDGRTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)53
MHC class II prediction (Propred)129
MHC class 1 prediction (Propred1)541
CTL epitope prediction (CTLpred)136
Prediction of interferon-gamma inducing peptides (IFNepitope)368
Prediction of IL4 inducing peptides (IL4pred)460