Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386003986
StrainMtb_RGTB423
Protein IDYP_005922265.1
Description persistence regulator MRPA [Mycobacterium tuberculosis RGTB423]
Sequence MRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVL
DVMMPRLDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLP
KPFALEELLARMRALLRRTKPEDAAESMAMRFSDLTLDPVTREVNRGQRR
ISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYL
RRKTEADGEPRLIHTVRGVGYVLRETPP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)22
MHC class II prediction (Propred)42
MHC class 1 prediction (Propred1)159
CTL epitope prediction (CTLpred)47
Prediction of interferon-gamma inducing peptides (IFNepitope)79
Prediction of IL4 inducing peptides (IL4pred)150